TB-500 (Thymosin Beta-4)

TB-500 5mg – High-Quality Research Peptide

TB-500, offered at 5mg, is a high-quality, specialised research peptide developed for advanced scientific exploration in cellular biology and actin-related signalling pathways. This product is ideal for laboratory settings where precision and reliability are paramount.

• Product Name: TB-500 5mg
• Catalogue Number: TB500-5mg
• Molecular Formula: C212H350N56O78S
• Molecular Weight: 4963.4 g/mol
• Purity: ≥98%
• Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
• Form: Lyophilised Solid

Usage and Storage:

TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website’s detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:

TB-500 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.